Tesamorelin Sequence
Tesamorelin contains a 44-residue GHRH-derived peptide sequence:
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
PubChem currently identifies this sequence for both Tesamorelin and the standardized Tesamorelin-acetate representation.
Molecular Formula
For Tesamorelin itself, PubChem reports:
C221H366N72O67S
Molecular Weight
PubChem reports an approximate molecular weight of:
5136 g/mol
N-Terminal Modification
Tesamorelin contains an N-terminal trans-3-hexenoyl modification.
This modification is part of the defined molecular identity of Tesamorelin and distinguishes it structurally from native GHRH.
Tesamorelin vs. Tesamorelin Acetate
| Property | Tesamorelin | Tesamorelin Acetate |
|---|---|---|
| Parent peptide | Tesamorelin | Tesamorelin |
| Sequence | Same 44-residue peptide | Same peptide component |
| CAS | 218949-48-5 | 901758-09-6 |
| Formula | C221H366N72O67S | C223H370N72O69S |
| Approx. MW | 5136 g/mol | 5196 g/mol |
| Acetate represented | No | Yes |
Tesamorelin 10 mg Research Material
Continue the Tesamorelin Research Cluster
View Tesamorelin 10 mg Research Material for the product-specific research-material page.
