September 17, 2026

MOTS-c Analytical Testing: HPLC, LC-MS and Batch Verification

How Is MOTS-c Research Material Evaluated? MOTS-c is a defined 16-amino-acid synthetic peptide. That gives researchers a known molecular reference

Read Research Article

September 17, 2026

MOTS-c Research in 2026: Mitochondrial Signaling and Current Scientific Directions

MOTS-c Research in 2026 MOTS-c research has progressed considerably since the peptide was first reported in 2015. Early work centered

Read Research Article

September 17, 2026

MOTS-c Sequence, Structure and Molecular Characteristics

MOTS-c Sequence MOTS-c is a compact 16-amino-acid mitochondrial-derived peptide with the sequence: MRWQEMGYIFYPRKLR The corresponding residue sequence is: Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg PubChem

Read Research Article

September 17, 2026

What Is MOTS-c? A Scientific Guide to the Mitochondrial-Derived Peptide

What Is MOTS-c? MOTS-c is a 16-amino-acid mitochondrial-derived peptide that has become an important research model for studying communication between

Read Research Article

September 16, 2026

Tesamorelin Analytical Testing: HPLC, LC-MS and Batch Verification

How Is Tesamorelin Analyzed? Tesamorelin is a relatively large synthetic peptide, so analytical characterization may require several complementary methods. Researchers

Read Research Article

September 16, 2026

Tesamorelin Research in 2026: Current Evidence and GHRH Science

Tesamorelin Research in 2026 Tesamorelin research in 2026 spans both molecular GHRH biology and an established body of pharmaceutical clinical

Read Research Article

September 16, 2026

Tesamorelin Sequence, Structure and Molecular Characteristics

Tesamorelin Sequence Tesamorelin contains a 44-residue GHRH-derived peptide sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL PubChem currently identifies this sequence for both Tesamorelin and the

Read Research Article

September 16, 2026

What Is Tesamorelin? A Scientific Guide to the GHRH Analog

What Is Tesamorelin? Tesamorelin is a synthetic 44-residue peptide analog of human growth hormone-releasing hormone, commonly abbreviated GHRH. It incorporates

Read Research Article

September 9, 2026

BPC-157 Analytical Testing: HPLC, LC-MS and Batch Verification

How Is BPC-157 Analyzed? BPC-157 is a defined 15-residue peptide, making its analytical evaluation fundamentally different from simply reading a

Read Research Article

September 9, 2026

BPC-157 Research in 2026: Current Evidence and Scientific Developments

BPC-157 continues to attract substantial scientific and public interest, but the current evidence base requires careful interpretation. The central issue

Read Research Article

September 9, 2026

BPC-157 Sequence, Structure and Molecular Characteristics

The molecular identity of BPC-157 begins with its amino-acid sequence. GEPPPGKPADDAGLV This sequence contains 15 residues and therefore defines BPC-157

Read Research Article

September 9, 2026

What Is BPC-157?

BPC-157 is a synthetic peptide containing 15 amino-acid residues with the sequence GEPPPGKPADDAGLV. It is commonly described as a pentadecapeptide

Read Research Article